ProxifyListing closed

Senior Fullstack Ruby on Rails Developer

Remote (CET (+/- 3 hours))Remote (region-locked)SeniorFound Jun 12
Apply to this job

Free credits included. Sign up to start applying with Jobfinder.

This role appears to be closed. You can still add it as a target and let your agent watch for the next opening like it.
ruby on railsrubypostgresqlmysqlsidekiqredisrspechotwire

About us:

Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂

Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives.

Proxify is shaped by a global network of supportive, talented developers interested in remote full-time jobs. Our Glassdoor (4.5/5) and Trustpilot (4.8/5) ratings reflect the trust developers place in us and our commitment to our members' success.

The Role:

We are looking for a Senior Fullstack Ruby on Rails Developer to join one of our high-growth client teams. In this role, you will be a key driver of the application's lifecycle, writing clean, idiomatic Ruby code to build robust backend features while ensuring a smooth, highly interactive frontend user experience.

You will help the client leverage the "Rails way" to ship features quickly, without sacrificing long-term maintainability, testability, or performance. This is an ideal position for a developer who appreciates the elegant architecture of Rails but understands how to optimize database queries, scale background workers, and deliver a modern interface.

What we are looking for:

  • 5+ years of production experience building and scaling applications using Ruby on Rails (Rails 6/7) and modern Ruby 3.x features.
  • Strong proficiency with frontend assets in Rails. This includes deep experience with Hotwire (Turbo/Stimulus) OR modern SPA frameworks like React.js or Vue.js connected via a Rails API.
  • Deep knowledge of PostgreSQL or MySQL, specifically in writing complex ActiveRecord queries, optimizing indexes, and managing database migrations safely at scale.
  • Extensive experience managing background jobs, race conditions, and heavy data processing using Sidekiq and Redis.
  • A strict habit of writing maintainable test suites using RSpec, Capybara, or FactoryBot to ensure high test coverage and stable deployments.
  • Proven track record of designing, securing, and documenting clean RESTful APIs.
  • Solid understanding of Git workflows, Docker containerization, and asset compilation pipelines (Propshaft, Webpacker, or Vite Ruby).

Nice-to-Have:

  • Experience migrating legacy Rails applications to newer versions.
  • Familiarity with cloud platforms (AWS, Heroku, or Render) and CI/CD pipelines.
  • Understanding of domain-driven patterns within Rails to keep large codebases decoupled.
  • Knowledge of web security best practices (OWASP Top 10, cross-site scripting prevention).

Responsibilities:

  • Design, architect, and implement clean, test-driven features across both the backend and frontend layers.
  • Profile and optimize slow queries, eliminate N+1 query bugs, and optimize frontend rendering paths to keep application response times low.
  • Participate in rigorous peer code reviews, championing idiomatic Ruby patterns, security protocols, and robust architectural choices.
  • Act as a technical sounding board for Product and Design teams, helping evaluate the technical feasibility of upcoming features.
  • Assist in maintaining and improving deployment workflows to ensure reliable, zero-downtime releases.

What we offer:

Get paid, not played

No more unreliable clients. Enjoy on-time monthly payments with flexible withdrawal options.

Predictable project hours

Enjoy a harmonious work-life balance with consistent 8-hour working days with clients.

Flex days, so you can recharge

Enjoy up to 24 flex days off per year without losing pay, for full-time positions found through Proxify.

Career-accelerating positions at cutting-edge companies

Discover exclusive long-term remote positions at the world's most exciting companies.

Hand-picked opportunities just for you

Skip the typical recruitment roadblocks and biases with personally matched positions.

One seamless process, multiple opportunities

A one-time contracting process for endless opportunities, with no extra assessments.

Compensation

Enjoy the same pay, every month with positions landed through Proxify.

ProxifySenior Fullstack Ruby on Rails Developer
Apply to this job