← All jobs
preply

Senior Data Analyst - Marketplace Analytics

This role appears to be closed. Browse the similar open roles below — or let your agent watch for the next opening like it.

LondonOn-siteSeniorvia ashby
data analysisanalyticsmetricskpirevenueretentionsqlpresentation

Observed pay for data analyst jobs

Among 31 openings that publish compensation, the median stated annual range is $69K–$90K USD. This uses observed listing data across 491 live jobs, never an estimated salary.

Don't apply into the void.

Most applications for this preply role vanish into an ATS. With jobfinder-ai, your agent finds the actual hiring manager or founder behind this opening and sends a tailored email from your own inbox — so a real person reads your pitch and replies. We then follow up until you land on the calendar.

Reach the decision-maker — $5

View original posting →

We power people’s progress. At Preply, we’re all about creating life-changing learning experiences. We help people discover the magic of the perfect tutor, craft a personalised learning journey, and stay motivated to keep growing. Our approach is human-led, tech-enabled - and it’s creating real impact. We’ve just reached unicorn status with a $150M Series D, accelerating our vision to transform education through human-led, AI-enhanced learning. Today, 100,000+ tutors teach 90+ languages to learners in 180 countries - and we’re only getting started. As a category-defining company, we’re shaping what the future of learning looks like at global scale. Every Preply lesson sparks change, fuels ambition, and drives progress that matters. Joining Preply means helping define the future of education at global scale, and building something that truly matters for millions of people, every day. Meet the team! This role is embedded within either the B2B or Customer Care domain and is part of Preply’s Data Chapter. You will work closely with directors, operations leaders, and cross-functional partners across finance and product teams, while collaborating with data analysts, data scientists, and analytics engineers to strengthen analytical foundations and business impact. What you’ll be doing: You will partner with senior stakeholders in Business and Operations teams to proactively identify where new analyses, metrics, or frameworks can unlock improvements in retention, revenue, and operational efficiency. Lead high-complexity, end-to-end analytical initiatives, from ambiguous problem framing to business impact, uncovering root causes and hidden drivers behind key performance metrics such as revenue retention, LTV, churn, utilization, operational metrics, and cost efficiency Design and validate KPI frameworks to ensure consistency, reliability, and cross-team alignment; clarify trade-offs in definitions and measurement logic across Operations, Finance, Marketing, and Product Design executive-ready storytelling and structured presentations that align stakeholders around shared goals, timelines, and trade-offs Embed analytics into daily workflows by partnering with business and operational leaders to integrate dashboards, forecasting, and reporting into decision-making processes Translate insights into strategic decisions, clearly articulating what was observed, why it matters, opportunity cost, and what action should follow, influencing roadmap, prioritisation, and resource allocation What you need to succeed: 5+ years of experience in analytics roles (Business, Product, Growth, B2B, or Operations), with demonstrated ownership of KPI frameworks and measurable impact on retention, revenue, or efficiency Strong business acumen and strategic thinking, with the ability to connect analytical insights to financial impact, opportunity cost, and roadmap prioritisation. Strong SQL skills with the ability to independently build and optimise complex queries Deep understanding of retention and performance metrics (e.g.revenue retention, LTV, churn, utilization, operational metrics, and cost efficiency) and the ability to validate KPI definitions and reporting logic across teams Proven ability to lead cross-functional analytical projects end-to-end Experience influencing Senior stakeholders, acting as a thought partner to Business, Operations, Finance, Marketing, or Product; comfortable clarifying trade-offs in metrics, accuracy, speed, and resource allocation Structured, rigorous analytical thinking with high attention to detail Experience improving metric definitions or analytical data models Nice to have: Experience in marketplace, subscription, or SaaS businesses Exposure to B2B revenue models or customer support operations Hands-on experience with Looker and Snowflake (experience with BI and SQL databases a must) Why you’ll love it at Preply: An open, collaborative, dynamic and diverse culture; A generous monthly allowance for lessons on Preply.com , Learning & Development budget and time off for your self-development; A competitive financial package with equity, leave allowance and health insurance; Not in Barcelona? We offer an attractive relocation package to join us in our Preply Barcelona Hub Access to free mental health support platforms; Access to Gympass-partnered wellness and gym centers throughout Spain to promote and support well-being and physical health; The opportunity to unlock the potential of learners and tutors through language learning and teaching in 175 countries (and counting!). #LI-AG1 Our Principles Care to change the world - We are passionate about our work and care deeply about its impact to be life changing. We do it for learners - For both Preply and tutors, learners are why we do what we do. Every day we focus on empowering tutors to deliver an exceptional learning experience. Keep perfecting - To create an outstanding customer experience, we focus on simplicity, smoothness, and enjoyment, continually perfecting it as every detail matters. Now is the time - In a fast-paced world, it matters how quickly we act. Now is the time to make great things happen. Disciplined execution - What makes us disciplined is the excellence in our execution. We set clear goals, focus on what matters, and utilize our resources efficiently. Dive deep - We leverage business acumen and curiosity to investigate disparities between numbers and stories, unlocking meaningful insights to guide our decisions. Growth mindset - We proactively seek growth opportunities and believe today's best performance becomes tomorrow's starting point. We humbly embrace feedback and learn from setbacks. Raise the bar - We raise our performance standards continuously, alongside each new hire and promotion. We build diverse and high-performing teams that can make a real difference. Challenge, disagree and commit - We value open and candid communication, even when we don’t fully agree. We speak our minds, challenge when necessary, and fully commit to decisions once made. One Preply - We prioritize collaboration, inclusion, and the success of our team over personal ambitions. Together, we support and celebrate each other's progress. Diversity, Equity, and Inclusion Preply.com is committed to creating an inclusive environment where people of diverse backgrounds can thrive. We believe that the presence of different opinions and viewpoints is a key ingredient for our success as a multicultural Ed-Tech company. That means that Preply will consider all applications for employment without regard to race, color, religion, gender identity or expression, sexual orientation, national origin, disability, age or veteran status.

Set this role as a target and your agent does the sourcing, finds the verified email, writes the pitch, and follows up — on autopilot.

Start your hunt